Hariyanavidyamandir.org valuation and analysis
Robots.txt Information
| Robot | Path | Permission |
| GoogleBot | / | ✔ |
| BingBot | / | ✔ |
| BaiduSpider | / | ✔ |
| YandexBot | / | ✔ |
Meta Tags
| Title | Hariyana Vidya Mandir |
| Description | Hariyana Vidya Mandir |
| Keywords | N/A |
Server Information
| WebSite | |
| Host IP | 103.227.62.62 |
| Location | India |
Related Websites
| Site | Rank |
| vidya-mandir.edu.in | #871,082 |
| vidyamandirestancia.com | #7,833,652 |
| vidyamandirpublicschool.com | #4,418,966 |
| srikanchimahaswamividyamandir.org | #3,185,315 |
More to Explore
Hariyanavidyamandir.org Valuation
|
US$129,177
Last updated: Apr 9, 2020
Hariyanavidyamandir.org has global traffic rank of 784,738 and ranks the 78,307th in India. Its global rank has gone up by 31,936 positions since 3 months ago. Hariyanavidyamandir.org has an estimated worth of US$ 129,177, based on its estimated Ads revenue. Hariyanavidyamandir.org receives approximately 3,998 unique visitors each day. Its web server is located in India, with IP address 103.227.62.62. According to SiteAdvisor, hariyanavidyamandir.org is safe to visit. |
Traffic & Worth Estimates
| Purchase/Sale Value | US$129,177 |
| Daily Ads Revenue | US$70 |
| Monthly Ads Revenue | US$2,123 |
| Yearly Ads Revenue | US$25,835 |
| Daily Unique Visitors | 3,998 |
| Note: All traffic and earnings values are estimates. | |
Traffic Ranks
| Global Rank | 784,738 |
| Delta (90 Days) | ⬆️ 31,936 |
| Most Popular In Country | India |
| Country Rank | 78,307 |
DNS Records
| Host | Type | TTL | Data |
| hariyanavidyamandir.org | A | 3599 | IP: 103.227.62.62 |
| hariyanavidyamandir.org | MX | 3599 | Priority: 10 Target: mail.hariyanavidyamandir.org. |
| hariyanavidyamandir.org | NS | 3599 | Target: ns16.diadem-tech.com. |
| hariyanavidyamandir.org | NS | 3599 | Target: ns2.diadem-tech.com. |
| hariyanavidyamandir.org | TXT | 3599 | TXT: v=spf1 +a +mx ~all |
| hariyanavidyamandir.org | SOA | 3599 | MNAME: ns2.diadem-tech.com. RNAME: neogy.hertzcommunications.com. Serial: 2020040902 Refresh: 3600 Retry: 3600 Expire: 86400 Minimum TTL: 3600 |
HTTP Headers
HTTP/1.1 301 Moved Permanently Server: nginx Date: Thu, 09 Apr 2020 12:42:19 GMT Content-Type: text/html Content-Length: 162 Connection: keep-alive Location: https://hariyanavidyamandir.org/ HTTP/1.1 200 OK Server: nginx Date: Thu, 09 Apr 2020 12:42:20 GMT Content-Type: text/html; charset=utf-8 Transfer-Encoding: chunked Connection: keep-alive X-Powered-By: PHP/7.3.16 X-Logged-In: False P3P: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM" Expires: Wed, 17 Aug 2005 00:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: 7a34379e81358795896839d2b5ee4609=4n4h9u4j01hi2onm2flc97mi3h; path=/; HttpOnly Set-Cookie: sj_univer_tpl=sj_univer; expires=Tue, 30-Mar-2021 12:42:20 GMT; Max-Age=30672000; path=/ Last-Modified: Thu, 09 Apr 2020 12:42:20 GMT X-Powered-By: PleskLin |
Hariyanavidyamandir.org Whois Information
Domain Name: HARIYANAVIDYAMANDIR.ORG Registry Domain ID: D128481232-LROR Registrar WHOIS Server: whois.publicdomainregistry.com Registrar URL: http://www.publicdomainregistry.com Updated Date: 2019-12-10T09:57:18Z Creation Date: 2006-09-07T08:57:47Z Registry Expiry Date: 2020-09-07T08:57:47Z Registrar Registration Expiration Date: Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com Registrar IANA ID: 303 Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com Registrar Abuse Contact Phone: +1.2013775952 Reseller: Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registrant Organization: Hertz Communications Registrant State/Province: West Bengal Registrant Country: IN Name Server: NS2.DIADEM-TECH.COM Name Server: NS16.DIADEM-TECH.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/) |